SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000041548 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000041548
Domain Number 1 Region: 167-195
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000693
Family CCCH zinc finger 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000041548
Domain Number - Region: 72-92
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000811
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 363-407
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0275
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000041548   Gene: ENSDARG00000030335   Transcript: ENSDART00000041549
Sequence length 541
Comment pep:known chromosome:Zv9:6:52192958:52204460:1 gene:ENSDARG00000030335 transcript:ENSDART00000041549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDRDSAYLAGGGGSGSGDEGGSGTGVGEGRATAVGGSAGGTGGNGGPGAMGGGGALGNG
NSSSSALGLDGVCRDFLRNVCKRGKRCRFRHPDFNEVPDLGVQKNEFIFCHDHQNKECVR
PNCRFVHGSKEDEDYYKKTGELPLRLRGKVAAGLGLSPTDLPFSRGEVPICRDYLKGECQ
RGNKCKFRHVRKDYDYEASSRVGVGCMIGVTGGVSGMVNSGGGGAGGVGSACGGMAGLVA
GGVGNYIGMGCPSLGGCREQGLSGGVGGGGSLSGCLSIGTAGHRRYDRGPCSVYDPLFEN
GIFEAGPVEAPVDHTVLQLKRRRLEGLRLADGTSGGHYDLGLQATLATRPVEYRLLEEEN
ALLRKRVEELKKQVSNLIATNEVLLEQNAQFRSQAKVMTLSSTPAPSEQSLAPPVGSVSS
YNHGIAQTHTTLSSAGLQTRPVTQQDLVAPSGAPTAPPANAAPPTAPPPHLNPDPISAAL
AQTIAQGMAPPVSMAPVAVSVAPVAVSMAQPLPGITMSHATTPMVTYPIASQSMRITTLP
H
Download sequence
Identical sequences Q6ZM22
ENSDARP00000041548 NP_996981.1.45394 7955.ENSDARP00000041548 ENSDARP00000041548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]