SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000042480 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000042480
Domain Number 1 Region: 232-288
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000122
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000042480   Gene: ENSDARG00000030887   Transcript: ENSDART00000042481
Sequence length 296
Comment pep:known chromosome:Zv9:5:25909253:25914153:-1 gene:ENSDARG00000030887 transcript:ENSDART00000042481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGIMDHHQDTVRKCKSEALPPERRKRTVEDFNKFCSFVLTYAGYIPPQKEESSWSPSSS
PCTHDLSELSGEGSVKDSWTDSHSDLNNIHNLVYKAETDSSSSREFSHLPSDNSLDKMTL
KDSLNHVHSKAERKKVKKLDRLSLGGPRKSISEARAHKQSKAALKKIKTSIKAERHFTSS
SPLNEGFEKEELTEQAIHMHEAGLKLESNQETDLSSCETDTLVTDEDIMVESGDDSWDLI
TCYCGKPFAGRPMIECEECSIWVHLSCAKIKKSNVPDIFYCYRCLDSRGSTVKRDH
Download sequence
Identical sequences A8E514 Q5BJ10
NP_001013517.1.45394 7955.ENSDARP00000042480 ENSDARP00000042480 ENSDARP00000042480 ENSDARP00000105631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]