SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000043111 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000043111
Domain Number 1 Region: 205-552
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-91
Family Calpain large subunit, catalytic domain (domain II) 0.00018
Further Details:      
 
Domain Number 2 Region: 691-814
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.71e-27
Family Calpain large subunit, middle domain (domain III) 0.0014
Further Details:      
 
Domain Number 3 Region: 549-684
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.83e-23
Family Calpain large subunit, middle domain (domain III) 0.0062
Further Details:      
 
Domain Number 4 Region: 87-166
Classification Level Classification E-value
Superfamily MIT domain 7.19e-20
Family MIT domain 0.0014
Further Details:      
 
Domain Number 5 Region: 2-81
Classification Level Classification E-value
Superfamily MIT domain 0.000000000000262
Family MIT domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000043111   Gene: ENSDARG00000076931   Transcript: ENSDART00000043112
Sequence length 815
Comment pep:known scaffold:Zv9:Zv9_scaffold3563:162372:191165:1 gene:ENSDARG00000076931 transcript:ENSDART00000043112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCTALELDAIKFAKSAVLYDQRGKYNEAVFYYKEAAQALIYAGMAGSKLENIQDKVNEY
LDRVQTLLSAVQAQSSDPLKSKHQLDLERAYFLVTQAFEEDEKENADEAIELYTQAVELC
IQASNETSDPALQAKLKQLARQALDRAEGLKDSVSKPASQDKPGSSASKGPAQVRQFFPL
GPDFSIHDKAQPVRAAQSSEPQGQRYTAEEIEVLRKTSKINGIEYVPFMSVDLRERFAFP
VPFSDKCGKLALSPKQKAIFSRWVRPDDICNNPTMIFTVSSFSIKQTVVSDCSFVASLAI
SAAYERRYSKKLITSIIYPQNRKGEPEYNPCGKYMVKLHINGVPRKVIIDDFLPVDRNGE
LLCSYSSNRNELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDNQSFN
KDDTFRMLYQRFHRGDVLITTATGVMTEEEGERWGLVPTHAYAVLDIRQYKDKRFLQLKN
PWSHLRWKGSYSERDEKNWTPDLLKYLNFDPKTAQKFDNGVFWIIWEDLCQYYDVIYLSW
NPALFKESSCIHSSWDGKQGPVKDVYSLANNPQYKLEVQCPQGGAAVWVLLTRHITDKDD
FAQNREFITLVVYKTNGKKVYYPAEPPPYIDGIRINSPHYLTKIKLTSPGTHTFTLVVSQ
YEKQNTINYTLRVYSVCKFNFSKIPTPFTNTKRINGQWKGASAGGCGNYKDTYKNNPIYQ
LNMEKPGPLLIELRGSRQYSVGFEVVTVSTTGDSGSSGFQKRASGDYRCGFCYMEVESLP
AGIYNVIPTTFLPKQEGPFFLDFSSVAPLRVSQLQ
Download sequence
Identical sequences A0A0R4IN63
ENSDARP00000043111 ENSDARP00000043111 7955.ENSDARP00000043111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]