SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000043315 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000043315
Domain Number 1 Region: 199-482
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-66
Family Extended AAA-ATPase domain 0.00000441
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000043315
Domain Number - Region: 9-70
Classification Level Classification E-value
Superfamily MIT domain 0.00353
Family MIT domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000043315   Gene: ENSDARG00000021827   Transcript: ENSDART00000043316
Sequence length 485
Comment pep:known chromosome:Zv9:20:23843640:23858390:-1 gene:ENSDARG00000021827 transcript:ENSDART00000043316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGEINENVKLAREYALLGNYSSAVVCYQGVLEQIKKYLYSVRDSSLQQKWQQVWQEIN
EETKQVREIMTTLESFQMESTPSKPSSFAQDNDIMPVHVEHRSSPCVVRKSSVPYKDSKG
HGNRLSVGPRGQARPSPRVANGDKGKPQKSKEKKENPSKPKEDKNKAEAVETEVKRFDRG
GEDKDLIDALERDIISQNPNVTWDDIADLEEAKKLLKEAVVLPMWMPEFFKGIRRPWKGV
LMVGPPGTGKTLLAKAVATECRTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPTTI
FIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDPSKMVMVLAATNFPWDID
EALRRRLEKRIYIPLPSAKGRVDLLKINLKELDLANDVNMDKIAEQMEGYSGADITNVCR
DASLMAMRRRIEGLTPEEIRNLPKDEMHMPTTMEDFETALKKVSKSVSAADLEKYEKWIA
EFGSC
Download sequence
Identical sequences Q5RII9
7955.ENSDARP00000043315 NP_001018440.1.45394 XP_021324094.1.45394 ENSDARP00000043315 ENSDARP00000043315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]