SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000044811 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000044811
Domain Number 1 Region: 21-341
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000549
Family WD40-repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000044811   Gene: ENSDARG00000079457   Transcript: ENSDART00000044812
Sequence length 836
Comment pep:known chromosome:Zv9:12:28110053:28118020:1 gene:ENSDARG00000079457 transcript:ENSDART00000044812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARCSVEFLSEFSDCQSDSVRFIREDTNLFLTSGHRDVLIFSVQDRKVKTVIQFEDSV
TFLDLSDDKHRLYALCKNGGLYCIPLPQQSGKKILINNSSPVNKSPEPMLHVVSDDSLVL
KNAGLQAFTIVKKILVTLSLDKSVWSFNLYEEPGSKPFCKLAHIQITTVTTCCLNVADKE
TSVSSPPVLTCIHPEGSTSVKTHQSDLHPHLEPHLFRLLFGVDAALVSSPVILCGLPDGR
ICCFPLLVPTLTGPRGEQRSPIRVLQSLEQPIVFIGTCISGEHGPQSLIVVGQRGKLLMV
RSKPRSSEGKEADYSKEHSVRGPVLCACVDDKRLFYSSLNDFHALQLTTSSSSEAMGTEP
QLQALISNSLGVCRVIALAGPYTNPTGSVQLLALSSSGRLMRVNLPQGSEKGILSRLSSS
LAGQRVKDLLASIGNVWERAESLKQKLQEKNESLKQLNQVLNICSLLLESNGKEKQSNMD
TKPLISCHGAARWSSLLQKTSLTLTCVLENSSGCTLEHGWTLCFQVHSFYQHPNTESASS
SYSFPLRKLDSGQKLDVTIPLESNGGLFLPVKVCCSLSFSLCALFGPEASSPGVFQLLKE
AGSISATLNTLTVDWLDALRLEGSFSPNDIRCNTVSEGIQAFLRSRGVSTKHLDNISNPG
PVAVVVSVSIELLKSKLHLSTTSSLESSMSVLNWLVSPEKIGSVKSPVVNAYSPDGCSVK
IMAKEVTLGDFYSEGPLEALEIRVESSSVAAVCGLHHAILRRLLDLLRDSSAQYSHTRNL
KAQSLCEAVRHVESLYKDLQDAQNKAALGGEMKTSQRSDVLFHIFQELRTNPLVIL
Download sequence
Identical sequences ENSDARP00000044811 ENSDARP00000044811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]