SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045014 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045014
Domain Number 1 Region: 4-279
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-63
Family WD40-repeat 0.000000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045014   Gene: ENSDARG00000034480   Transcript: ENSDART00000045015
Sequence length 279
Comment pep:known chromosome:Zv9:11:45322434:45355583:1 gene:ENSDARG00000034480 transcript:ENSDART00000045015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELEQLRQEADQLRNQIRDARKACSDSTLSQMTASLDSVGRIQMRTRRTLRGHLAKIYA
MHWGSDSRLLVSASQDGKLIIWDGYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSTYSLKTREGNVRVNRELAGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTTSF
TGHTGDVMSLSVSPDSKTFVSGACDASAKLWDIRDGMCRQSFTGHVSDINAVCFFPNGNA
FTTGSDDATCRLFDLRADQELMMYTHDNIICGITSVAFS
Download sequence
Identical sequences Q5U3U8
ENSDARP00000045014 ENSDARP00000045014 NP_001007453.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]