SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045134 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045134
Domain Number 1 Region: 81-155
Classification Level Classification E-value
Superfamily F-box domain 1.03e-19
Family F-box domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045134   Gene: ENSDARG00000033949   Transcript: ENSDART00000045135
Sequence length 356
Comment pep:known chromosome:Zv9:20:35272020:35279249:1 gene:ENSDARG00000033949 transcript:ENSDART00000045135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAPSTKMQTKLSTWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCS
AGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELD
QLWMPKCLKLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGS
ETEGSLPLTGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDNLHPGE
HARKALLKTRQEDTIKAPSHSTYKLRKAKSLMFLSLDLSKAGKPSHNRPKWAARNLEALP
ADKDSIKRISQTSQWNAGIRPGPVRPPVPRLSKEGFRASQRSHRSTPTVTLFEGQP
Download sequence
Identical sequences Q5TZ36
7955.ENSDARP00000045134 ENSDARP00000045134 ENSDARP00000045134 ENSDARP00000127268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]