SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000045244 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000045244
Domain Number 1 Region: 170-249
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.94e-25
Family PHD domain 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000045244   Gene: ENSDARG00000030716   Transcript: ENSDART00000045245
Sequence length 250
Comment pep:known chromosome:Zv9:19:10135518:10145084:-1 gene:ENSDARG00000030716 transcript:ENSDART00000045245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKGQIDSLAREYTANARTLSSEQ
KLSLLRQIQQSYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESTD
YDSTSSKGNKSDIRGPKKKEVNRARSKVKNSDDDCSSKSGQKKVKLTQSTEFSTPAVNFG
NVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYC
PRCSQERKKK
Download sequence
Identical sequences Q4VBS0
ENSDARP00000045244 NP_001018304.1.45394 ENSDARP00000045244 7955.ENSDARP00000045244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]