SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000046839 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000046839
Domain Number 1 Region: 8-77
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.08e-20
Family ECR1 N-terminal domain-like 0.00086
Further Details:      
 
Domain Number 2 Region: 166-243
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.35e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000669
Further Details:      
 
Domain Number 3 Region: 78-161
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.04e-19
Family Cold shock DNA-binding domain-like 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000046839   Gene: ENSDARG00000029187   Transcript: ENSDART00000046840
Sequence length 247
Comment pep:novel chromosome:Zv9:14:53498788:53502929:1 gene:ENSDARG00000029187 transcript:ENSDART00000046840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSVHTSLLERIGDVVLPGDLLFSFSPPEAGDANPKADRLICGPGLRRSGAEIRVCRAG
VLKHKQPNMYWVNCQQRRYVPAKGESVIGIVTAKSGDVFKVDVGGSEQASLSYLAFEGAT
KRNRPNVQVGDLVFGQFTIANKDMEPELVCIDSCGRANGMGVFGGDGLLFKVSLGLVRRL
LAPQSDLVSDLEKMFPCEMVVGMNGRVWVKARTVQHTLILSNLLEASENMSTAQRHTLFS
RVADGGI
Download sequence
Identical sequences A0A0R4IRK6
ENSDARP00000046839 ENSDARP00000046839 7955.ENSDARP00000046839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]