SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000048656 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000048656
Domain Number 1 Region: 3976-4121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.91e-33
Family Synaptotagmin-like (S variant) 0.00000604
Further Details:      
 
Domain Number 2 Region: 4340-4475
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.72e-19
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 
Domain Number 3 Region: 3780-3879
Classification Level Classification E-value
Superfamily PDZ domain-like 6.88e-17
Family PDZ domain 0.0000317
Further Details:      
 
Domain Number 4 Region: 463-529
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000134
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.033
Further Details:      
 
Domain Number 5 Region: 20-80
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000125
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000048656   Gene: ENSDARG00000012482   Transcript: ENSDART00000048657
Sequence length 4478
Comment pep:known chromosome:Zv9:18:9086068:9172989:1 gene:ENSDARG00000012482 transcript:ENSDART00000048657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQEGKMKEIQAKAVIKEEVYKSEPPKACPLCKAEIIKNPPNYSTCTTCKNTVCNLCGFNP
LPHQTEMKEWLCLNCQIQRAPIPPAGQPGPQTTKLPPPASPQKQHTPGVVAEDQKLDASG
QHKIKPNSADLKPPTSEAQKQKSEVLPAKSDQPHKPEPSKQTSSKTIPTPPTSRKGSVAP
PESKLNPPPVQSKPTSTPTQEQKVKSHQKAAPYKKPSVTADQDKKPLAETKELKTPNTQK
SKGDVPSSKPVPPPKGEQVKEESSFFGFGFGSSRSRSPSPSPQAAVSDKDAKQKQPQRES
KPAVSSIQDQKPVSKTQDPQLVKPAHTSEEEAEFFSFGFGGARSGSPQPSVTAVSGKVLG
FGSSFLSSASNLISTAMQDDSSTTPPTSPVQDEPSKTPPTSRKGSTVSQTSTKATAPTSR
KGSAVAPDSSKVSPVGDTKTQAAQDVEKKTEIKQVTSPKPPEKSASKEVKTNCPICKVKL
NIDSKDAKNFNTCTECKMTVCSQCGFNPMPHQHEVEEWLCLNCQVQRAQQGVKSPSTLPQ
LGGPKAQPSSPKPTDSGTVNSQTVPLVKDNQTTSKVDKVAPVESKPDENPTAAPIEKKVV
PTQEIKKDISVQKTSSDAKPTDKITSSKDLPKQDKTKTEPEKTQQQPTKDTIIPASNLIN
SAVQDESSKTPPTSRKGSTVSQTSTKATPPTSRKGSAVALDSSKVSPVGDNKSQAVQDVL
LFICILSTKPSHKQCSYMHLLISDNQSTSKADKVAPAPVESKLDEDSTAAPTEKMAAPDQ
EIKKDISVQKTSSDAKSADMITSSKDLPKPDNTKPEPTSTKATPPTSRKGSAVAPDSSKV
QPTEDTKTQAAQDVEKKTDIKQVTSPKPLQKPAPKEVKTNCPLCKVELNIDSKDDNQTTS
KADKVAPAPVKSKLDENPTAAPTEKKAGPAQEIKKDILSQQSPVKRSDFCLLESCLAKLL
KFHLYTIKNNLSCKSTHLVDTLKADTKEQQRKDILPVSVESYSSAEEELKEIQRVSEMAM
KETAAKLLPVRAQDNVKQYHEDSSESEPSPQIQRRRVRPPSSSSEDYKIDSSNSGDDEEF
IRRQLMSMGEDENLPSDEENIVKEQLDASQETKEVDSMKPKRALKKLTVEPEEYLSSHDQ
DDQVVQVIPVSEALEVSSVEIDVSVDNKITVTDTIAAAVTQKSPVRQTTEEYESLVEDSS
KGDGSSSVQVSSITPGTASPTSVSSIDEDSDSSPSHKKARAESKQQRKAKHRPHGQALAT
IEDSSEEDGLHEKGDQPMELEEERDDQQPKKGSRKMKTEKDELVMQRRRDHLTKTDKLRQ
VAGTEERKSSSFSDFSPSVESDAESAEYRTLSSETQEAAGKPLKNAEEVYEEMMLKAQEY
KTSEKFTPPDIEPLYGGMLIEDYAYETLVDEQDQAAAAFGNFTHGQDRESVRILMTPDEA
YEEMMRKRSKIVLKEEEAQQTYTTKIDTSLPLDDSDTCFVTISGNDALAADKNSKTLLQT
EDAYEELLKAQKDVLTPGTSPTPSTPLSPASPLTVSESSYDSPEVILIPSKSTSTQDAFV
NKTLYPIPDLKITQCSSGEDEIEEEDIARQEQISPEPTDVSLSEEEPQAPGELFENDPIS
VVCEVPSSKYVVETTTLSPLSPPTSPAISSPDSNLELATAPSSSPMSDQTSELTTPASPS
VADVSVPVVIHMPDLMDEQTTVHPSIAASAQTIVSSSPAILASHHVSEDASTPAPPEVLA
SKPTQGPKPTLAPKPTITKTIQQAVPSPEWVSTNTVDSTQKPLAGAIHEPTSVTKSAITD
KPTVAPMTAEKVDHVKMSTTPALTPIVQSQRLVETRSDIAPPLHQATPISPPPTMTQIPQ
KIIPDNAIPPIEQKPQSQQMAFQTTSSVTSSQPNPPATVASVTVKAAVTPTHKSPPPVPP
KPVCIPPGLVFSHRSRESIKPPVSPEPVVVQAVRAATLPRTREPPNALTLSLTAPIETKH
SASSPKSPLSPRFARTLETYVVITLPSEPGSPVETITTQAPEKTEIPSMTSATAVPPVPV
TFTQFTKSIESQEICGQDKFISSMSQVYSAISTTEQHPDTLPKLVTQVVTTEVQRTTTVS
VVQERIPVDPIPEPVSATVTIQPEVHQKSKQNGRIHYPTDVVDLTTFKVNVTMTDSGMDL
TAPDSSRSFLSSESSGRQATAVQPEIVNLSAEIIPSPTLSVVNDSITIVTCTATIAYNNN
STVDKPLDLGNATSVPLSLTTYNPFEPLAQIVYRPVNSQPKPPASAEIPVNLSNRSATIS
APPLMPLTVAPVSFTNGTVGIPMHTEPSVVGPVDLTTSKPLNTMVALSSSSGVVTNVVED
DGTPVDLTSGRRTVCCDVIYRLPFTGSCRTQPPVTTQPDTQIGYEIDDAEMPVIENLSTM
KTSISDSNFKETGLLSYERKNGFTYQNGAPEGAMDLTSAKMSMEEALDYSKKGTLAFTGI
TSTPYSQGTSYGVNSLLRSTNGIVYSSVAAPVPSTYAITTQPGSIFSTTHNSLTDPTEPL
SAFENQPAPYGFVHTATDQSIFSQSDISKDILPSALASLLPSLTAFPELYSDATLEAIAA
SLDTLVSPNFPDLDDSKSQQYKAEHEFLQLEKLKQLCLAEELEWERQEIQRYREQEQFIV
QKELEELQNMKQQLLMQQEEERKAQLILQQETFAQQQHQLEQIHRLQKQLQQQLEEQKIY
PYGFGPIEGMSPPMGSNIILDSKYSGGDNGQYWPVKDDNSMSSAVSTHDSTLVQNWQSTT
VQHSSNIPVTVSAQTKEQMQLSTNMSDSAKQEQNLGLSGKKLIESGVQTDDEDEVEKIPS
GRKRRSRRSVDSCVQTDDEDQDEWDVPVRSRRRSRSSRYADGEKGKSSKVSSIAIQTVAE
ISVQTEHSGTIRRSPVRAQVDTKVDLQREGQTESDSDITSDKDKRRPVPTGITVSTHLTA
DDVGTSMVTKSPKVLCSPVSPMSPGKSSQKMLTADSSRHLSSPRSLRASQRSLSDPKSLS
PTTEDRMMYQYSETYSSKGSQSGTPVGSYKKVKRTLPHPPPEEDNIIGLSGYTTSSTRRR
MCRNTTMARAKILQDIDKELDLVERESSKLRKIQAELDEEEKEIDAKLRYLEMGINRRKE
ALLTYLQGVAEERDYMSDSEVSNIREARGNGHGLERPRTAPQSEFNQFIPPQTESESQYA
QLTSPYSHYQYASQTSQYPQQTLYQQQSLYHQQVSPYQSIYSSVPSLNQQSQQTGYDHSS
LLLMQQKPRQTTLSDLEPKITTNYEVVRNQPLLIVPTSTESAYGVSHLGGKYSSLDLRMG
LEERASMASSPMSSISAESFYADLDHHNARNYVLIDDIGELTKSSTGLGSSYSIADKDIS
KADRLLRTADIRRTADVADFLSPLQSASRLHSYGKADEDSMEEPYELKMLKQQIKQEFRR
GTDSLEQLTGLPHYLHSDTSFRHFPKAEKYSIGRLTLEKQAAKQLPASVLYQKQLKNKKA
LIDPKITKFSPIQESRDIELDYSNFLASASSVGGLSARARLLQDEITFGLRKNLAEQQKY
LGSALGANLAQSLNFGQSLNLGPTIRSSLHEDGTYPSGTRSRPSSRPSSVYGLDLSIKRD
LSNSSLRLKTEGEGMDSQFVSRAKPTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMA
RASAGPLPPISADLRDQFGSSHSLPEVQQHMREESRTSGYERDIAFIKDDLQGAMSDSEA
YHLQHEETDWFDKPRQGRGGPESGPDRRQSHVLGHANTTPLSISSWKCIVHSTTYMKGSH
YPFPHTRIKLQRDPKDHSVSGSGLGIRVVGGKEIPGTNREIGAYIAKVSAGGYAEQTGKV
VEGMQVLEWNGISLLGKTYEEVQSIVGQQNGEVDVCVRLDLNMLSNTEQPQQLELHNQLR
AGERQRSPGVDPKQLAAELQKVSQQQGPASVLSALERAGHLHSGPGSAASSGVPSPGQPG
SPSVSKKRHSSKSAEALKPQPHPITGDIQLQINYDRNMGNLIVHVLQARNLAPRENNGYT
DPFVKVYLSKVKHQVMVVQNASAENKRRTKYIQKTQNPEWNQTVIYKNIHLEQLKKKTLE
VTVWDYDRYSSNDFLGEVLIDLSNTTQLDNTPRWHPLKEQSESIHHGRTHPPQGNQESPK
TSVIKSRSHGIFPDPAKDTQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKGSVTQAH
LEEAGNAIAAAEAAVHQSRLQPNDHHGGISARGGERHVTPASLSLNIQIKPSTKQAKFRS
QNLKHKILYIQPFFPTYSTKTNHRMTDGEGYTLDSEDSMGTNALDSAIFQVPQILRKNIP
NGTDKTRGLESLNLPDSEGKGKMMGEIKVALKKEMKTEGEQLVLEILQCRNITYKFKSPD
HLPDLYVKLYVVNVATQKRIIKKKTRVCRHDREPSFNETFRFNLNPVGHSIQLFLVSNGG
KFMKKTLIGEAYIWLDKVDMRKRAVSWHKLVPTTSQTQ
Download sequence
Identical sequences ENSDARP00000048656 ENSDARP00000048656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]