SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000049950 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000049950
Domain Number 1 Region: 40-120
Classification Level Classification E-value
Superfamily F-box domain 2.09e-19
Family F-box domain 0.0041
Further Details:      
 
Domain Number 2 Region: 124-263,309-397
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000589
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000049950   Gene: ENSDARG00000078003   Transcript: ENSDART00000049951
Sequence length 431
Comment pep:known chromosome:Zv9:9:17305496:17316134:-1 gene:ENSDARG00000078003 transcript:ENSDART00000049951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRLSKECEDSTSSCEGQTVSYKRPKQPSEDFGDLQSNWVRLPQEILLHIFQYLPLLDR
AFASQVCHNWNHAFHMPELWRCFEFELNQPATSYLKATHPDLIKQIIKRHSNHLQYVSFK
VDSSTESAETACDILSQLVNCSLKTLGLISTARPSFMELPKSHFISALTVVFVNSKSLSS
LKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLL
SDELLLALSSEKHVHLEHLRIDVVSENPGQQFHTIKKSSWDAMVRHSPKFNLVMYFFLYE
DEFGPFFRDEIPVTHLYFGRSVSKEVLGRVGMNCPRLVELVVCANGLRPLDEELIRIAER
CQFLSAIGLGECEVSCSAFVEFVKMCGRRLSQLSIMEEVLIPDHKYGLDEIHWEVSKHLG
RVWFPDMMPTW
Download sequence
Identical sequences Q7T162
ENSDARP00000049950 ENSDARP00000089339 ENSDARP00000110146 ENSDARP00000049950 XP_009302839.1.45394 7955.ENSDARP00000049950 7955.ENSDARP00000089339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]