SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000050825 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000050825
Domain Number - Region: 20-176
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00101
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000050825   Gene: ENSDARG00000029307   Transcript: ENSDART00000050826
Sequence length 657
Comment pep:known chromosome:Zv9:24:34696852:34714526:1 gene:ENSDARG00000029307 transcript:ENSDART00000050826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDEYYLELSENPVQFENASSVNNVFFDEANKQVFAVRSGGATGVVVKGPDDKSSVAFRM
DDKGEVKCIKFSLGNKILAVQRTTKSVDFINFIPDYPHLEFSHECKTKNASILGFCWTNW
NEIVFVTDQGIEFYQVLPDKRTLKLLKSQSINVNWYIYCPETAVLLLSTTVQGNVLQPFA
FKTATMSKMSKFEIELPAVPKPAKLSLSERDIAVATIYDQLYVMYLKHHSRTTNSPGAEV
VLYHLSVNCREGTCKRTNVLRLNTTGKFAINVVDNLVVVHHQSTQTSLIYDIKLRELDGN
VNVHQPVLPARSINPFKIPLTGPAAAPSQAPLPCELYSSSWSVFQPDIIISASEGILLTS
DSINQPTLNLLQDKGKLMDFLLRRRDCKMVILSVCSQMLIGGDKGNLSVVATVFDKLNQV
YKEYLDAEQAYTAAMESGPSRSSAYKRPVRTQAVIDQSDMYTHVLSDFTEKKEVKHKFII
AVVMEYIRSLNQFQIPVQHYLYELVIKTLVQHNLFYMLHQFLQYHVLTDSKPLACLLLSL
ESTYPPAYQLSLDMLKRLSTANDEIVEVLLSKQQVLGALRFIRSVGGHDNASARKFLDAA
RQTNDTMLFYTIFRFFETRNMRLRGNPGFNPGEHCEEHVSYFKQVFGESAVMKPTTA
Download sequence
Identical sequences ENSDARP00000050825 ENSDARP00000050825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]