SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000051773 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000051773
Domain Number - Region: 209-252
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0963
Family Tudor domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000051773   Gene: ENSDARG00000035697   Transcript: ENSDART00000051774
Sequence length 257
Comment pep:known chromosome:Zv9:8:690341:699975:1 gene:ENSDARG00000035697 transcript:ENSDART00000051774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPYRTHRSKHTGVRSVSSGRSTMKKKNSHKNRHARAVSPVRPLGQSVVGCRIQHLWKE
DVSSPVSLWKGTVLSQVEVDDSLFLIKYDGVDCVYGLQLFTDDRVRDLELQPGQIASFRV
SDSRLADRLLGRPVVHLFETDDGSKDEWKGLVLSRAPSMPAWFFITYEKDPMLYMYQLMQ
DYRDGDLRLLPDSDEAAELREAGEVSETLVGKQVECLNKDGAQKLGTIIQQVQAKPSVYF
IKFNDDYHIYVYDMVGS
Download sequence
Identical sequences F1R8A6
ENSDARP00000051773 ENSDARP00000051773 XP_017212817.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]