SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000054242 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000054242
Domain Number 1 Region: 325-391
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.31e-17
Family PHD domain 0.0042
Further Details:      
 
Domain Number 2 Region: 218-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000668
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 280-340
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000208
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000054242   Gene: ENSDARG00000037291   Transcript: ENSDART00000054243
Sequence length 405
Comment pep:known chromosome:Zv9:14:25267556:25277469:-1 gene:ENSDARG00000037291 transcript:ENSDART00000054243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAVENIVKVLGEQYYKDALEQCHNYNARLCAERSILMPFLDSQTGVAQSNCYIWMEKR
HRSAGTAPGQLYSYPARRWRKKRRAHPPEDPALVFPPLKTAELELGLKKDVLGPLDGSSL
EALLKGEPLDKRVTTELRPPEEETSLAEITGTSTASSHSGSTRIRKRILEPEDYLDDLDD
EDFEEETPKRRSKGKSKGRGVGNGKKKLEAAAAAQEDRDKPYACDICGKRYKNRPGLSYH
YTHSHLADEEGEDKEEPEIHTPAPPEEPKTPKKGPNGLALPNDYCDFCLGDSSMNQKTGQ
SEELVSCSDCGRSGHPSCLQFTAVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDC
DRGYHMYCLSPPMSDPPEGSWSCHLCLALLKDKASIYQSQNPAME
Download sequence
Identical sequences Q58E00
ENSDARP00000054242 NP_997861.2.45394 7955.ENSDARP00000054242 ENSDARP00000054242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]