SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000054475 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000054475
Domain Number 1 Region: 216-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.000037
Further Details:      
 
Domain Number 2 Region: 285-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000289
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000054475   Gene: ENSDARG00000037433   Transcript: ENSDART00000054476
Sequence length 569
Comment pep:known chromosome:Zv9:14:21157744:21190546:1 gene:ENSDARG00000037433 transcript:ENSDART00000054476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELAVEVRGASGAFYKAYIKDVHESTVTVAFENNWQPERQISFQDVRFPPPTGFQKEIN
ESDEVEVYSRANDKEPCGWWLAKVRMVKGEFYVIEYAACDATLNEIVTLERLRPVNPNKA
ATKNTFLKTRLDVPEDLRQMCAKDSAHKDFKKAIGAFNVTYDSEEKQLVILSVNEVTAKR
ISMLSDMHFRSLRTKLALILRNEEATRQLESSRQLASRFHEQFVVRDDLMGLAIGTHGAN
IQQARKISGVTTIDLDEETCTFHIYGEDQEAVRKARSYLEFSEDVIKVPRNLVGKVIGKS
GKLIQEVVDKSGVVRVRVEPENDKKPSPLEEGMVPFVFVGTKESISNARILLDYHLNYLK
EVDQLRMERLQIDEQLRQIGGGPRALPGRPEKEKSFMADNGMGPSRGGGKPFGRGGRGRR
GPTLASGTNSEASNASETESDHRDELSDWSLAPTDEESMGYPKRAPDGRKRGGGPRGRGG
RGRGGYKTEDMHWNDSRSRSSRDSKLRPQEESLQIRIDSNNERSIHTSRSSQAMAGDSGG
NRQRPIKERVMKKEKQDGSDSQAVVNGVS
Download sequence
Identical sequences F1R159
ENSDARP00000054475 7955.ENSDARP00000054475 ENSDARP00000054475 ENSDARP00000104665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]