SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055589 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055589
Domain Number 1 Region: 38-109
Classification Level Classification E-value
Superfamily SAND domain-like 3.49e-24
Family SAND domain 0.00068
Further Details:      
 
Domain Number 2 Region: 153-241
Classification Level Classification E-value
Superfamily SAND domain-like 8.89e-22
Family SAND domain 0.0035
Further Details:      
 
Domain Number 3 Region: 247-301
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000247
Family PHD domain 0.0061
Further Details:      
 
Domain Number 4 Region: 323-407
Classification Level Classification E-value
Superfamily Bromodomain 0.00000602
Family Bromodomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055589   Gene: ENSDARG00000038133   Transcript: ENSDART00000055590
Sequence length 408
Comment pep:known chromosome:Zv9:3:24932730:24941134:1 gene:ENSDARG00000038133 transcript:ENSDART00000055590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKSCKKSRQIRSSSICSSKRKKQAKSKNCLQSSSSQSRLPVTCGYKEGLLDLKKYYKR
QKCILSEDRWFTPTEFERFGRKEKNKKWRTSILCKGITLQKLIEDGFLLPKTFMKGRIHG
EKQKKRPEVLQQQVLESAEKSNGSQGEDDDDIDMTKFEGATLPVACGSNSGVLHKCRFAG
ERCGRCIRTENSWLTPEGFIKLNKPDGIWRKDIVSNGVPLGRLIKKKVLELHTINCDCEI
CQELDQHLNDDVCFVCNSEGNLVCCDECPRAFHHHCHLPAVPEDSSGKWSCIICVLKNMK
GSSQKNQQDIMSSPVSQYTQHCQCLLLHLLRECMTDPCTNIPGGSENICGPMMLGRVKQN
LENNNCPTVQVFVSDIEYVFHHCTSKRDNDFSRMMSRLMELLETIFKP
Download sequence
Identical sequences F1QT05
ENSDARP00000055589 ENSDARP00000110770 ENSDARP00000055589 7955.ENSDARP00000055589 NP_001017912.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]