SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055770 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055770
Domain Number 1 Region: 585-660
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 653-728
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000226
Further Details:      
 
Domain Number 3 Region: 147-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000141
Further Details:      
 
Domain Number 4 Region: 734-837
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.47e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 1064-1136
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.07e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.000059
Further Details:      
 
Domain Number 6 Region: 984-1060
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.92e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000171
Further Details:      
 
Domain Number 7 Region: 1130-1207
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000186
Further Details:      
 
Domain Number 8 Region: 508-583
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 9 Region: 221-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 10 Region: 348-434
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000827
Further Details:      
 
Domain Number 11 Region: 293-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 12 Region: 440-512
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000716
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000474
Further Details:      
 
Domain Number 13 Region: 872-924,960-983
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000716
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000055770
Domain Number - Region: 105-151
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0258
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055770   Gene: ENSDARG00000009830   Transcript: ENSDART00000055771
Sequence length 1285
Comment pep:known chromosome:Zv9:6:26584184:26600686:-1 gene:ENSDARG00000009830 transcript:ENSDART00000055771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFNEHRSGLLPEQVKAAAGGDPSSVEDDDSLPTYKDAFPPLPEKPLPEGV
QETENAWTTKIKPLKSSIITQVFHVPLEERKYKDMNQFGEGDQAKVCLDIMHKTGAHLEL
SMAKDQGLSIMVSGKYDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELE
LKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFI
TGAHGKLVGDLMQETGARINVPPPSVNKTEIVITGEKEQVALAMVKIKKLYEEKKKNATT
IAVEVKKSQHKYVIGPKGNTLQEILERTGVSVEIPPLDSSSETVILRGEPARLGQALTEV
YAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDV
QIVQGQIEVIVTDLVSRMDYTEISVDPKFHRHLIGKGGANTHQVNRIKELHKVSVRIPPD
NEKSNLIRIEGDPQGVQEAKKELLELASRMENERTKDMIIEQRFHRAIIGQKGEKIKEIR
DKFPEVIINFPDPAQKSDIVQLRGPRTEVEKCSKFMQKMVAEMVENSFSVSVPIFKQFHK
NIIGKGGANIKKIREETNTKIDLPAENSNSEMIVITGKKANCEAAKNRILAIQKELANIT
EVEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGIDAVTIRGPAEEVEKAKK
QLLSLAEEKQTKSHTVELRAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTAEDKDHELI
TVIGTEEAVAEAQKELEALIKSLDNIVEDFMIVDPKHHRFFVARRGQVLRDIADEYGGVI
VSFPRTAAQSDKVTLKGAKDCVEAAKKRMLEMIEDLDAQVTMECVIPQKFHRSIMGPKGS
RIQQITKDHNVQIKFPDREEQQQVLLSESTNPSADASVQENGEANGEVKEPVDPTAPKKC
DVIVLSGRKERCEAAVEALKALVPVTIAVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQV
PAHELQSDIISITGLASHLDRAKEGLLERVKELQAEQEDRALRSFKLTITVEPKYHPKII
GRKGAIISHIRHDHEVNIQFPEKNDENQDQITITGYEQNAIAARDAIQAIVDELEEMISE
DITLDSRVHARIIGARGKGIRKIMDEFKVDVRFPQSGAADPNLVTVTGRPEHVDEAIDHL
LNLEEEYMADVVENEAKMAYMKPSGSSASSMEEPRGPSKGFVVREAPWATGNEKAPDMSS
SEEFPSFGAPVAAAARASPWGPKRF
Download sequence
Identical sequences ENSDARP00000055770 ENSDARP00000055770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]