SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000055860 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000055860
Domain Number 1 Region: 55-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000489
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 311-357
Classification Level Classification E-value
Superfamily RING/U-box 0.00000027
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 246-282
Classification Level Classification E-value
Superfamily SAP domain 0.0000168
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000055860   Gene: ENSDARG00000038300   Transcript: ENSDART00000055861
Sequence length 363
Comment pep:known chromosome:Zv9:8:42161992:42186903:1 gene:ENSDARG00000038300 transcript:ENSDART00000055861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGASSMWASCCGLLNEVMGTGAVRGQQPGFGAGAGPFRFAPTAGYSTYPPANSNSTSL
VCQACRQAFSVFRRRYICCDCTKSFCSLCSVLQENLRRCTTCHLLKGTAFQRSQLMRLRV
KDLRQYLMLRNINTDTCREKEDLVDLVLCHHGAESEDDPDTPSLQSHPLYSPPPLIEEPT
SPLSALSPTREPISRSNSSESTNQDIEDSTSVSLLNLDQTEHTPEVSPQTRRRARASLSD
LSSLDDVEQLTVRQLKEILARNFVSFSGCCEKWELVERVRRLYRENEDNRKSMENVSNPI
TADSCRTQLSNDDNLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVIRAVHV
FKS
Download sequence
Identical sequences F1RAJ9
ENSDARP00000055860 ENSDARP00000055860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]