SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000056473 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000056473
Domain Number 1 Region: 148-221
Classification Level Classification E-value
Superfamily HMG-box 1.31e-20
Family HMG-box 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000056473   Gene: ENSDARG00000038672   Transcript: ENSDART00000056474
Sequence length 267
Comment pep:novel chromosome:Zv9:21:44001407:44020048:1 gene:ENSDARG00000038672 transcript:ENSDART00000056474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKVSVVQQGMHPLTPLLPYEHFNPSPTHMPTDGGQKPGVHRHQTQEISGFYSLPQGQIT
PSMNWPNQPVYPLPSCGFRQPFSSGLQSGSSYPRFSHSLMLQSGMHPTGIPHPAIVPPSG
KQEHDQFDRSIYNKSHAEAKREKEPKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAI
NQILGRRWHALTREEQAKYYELARKERQLHMQLYPSWSARDNYVSALGKKKRRKRDKQQD
SSTEPGSPKKCRARFGLNQQTDWCGPC
Download sequence
Identical sequences F1QZD5
ENSDARP00000056473 ENSDARP00000056473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]