SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000056961 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000056961
Domain Number 1 Region: 196-230
Classification Level Classification E-value
Superfamily F-box domain 0.000013
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 304-358
Classification Level Classification E-value
Superfamily RING/U-box 0.0000627
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000056961   Gene: ENSDARG00000039020   Transcript: ENSDART00000056962
Sequence length 384
Comment pep:known chromosome:Zv9:13:47400088:47413346:1 gene:ENSDARG00000039020 transcript:ENSDART00000056962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCPNYTEDSTVLCHMEKTETDLGEVKGHKVSPRKTGALPLRSPAATNVSTPLESRSKGP
HNKENYQNKRHSLDMASDDEVIFSGSGLTEDSGYLSLHNSQVDVDGLDSLERSEENCVSS
QSLDVECHSGPCLPVLNFQEEACRELQRSYKKNRSYDWTVVDKVAENFGLHNVIGGKMGR
QFVDILCKLMRKDMRHILARILGLLGDCDLISCTKVSRTWRKIICQDQLALQRWKKAEKT
RRDSGRSMGSLSRDFTLDRVVFSCMQTVSSPPAHKAVKKPPCQMGGAQNATKSSRFQQYV
EAAQSLKQHESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSTPCRNTI
RSFSSTQKTLVAGSARSKRSIRRL
Download sequence
Identical sequences F1QJI8
ENSDARP00000056961 ENSDARP00000056961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]