SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057072 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057072
Domain Number 1 Region: 214-320
Classification Level Classification E-value
Superfamily TPR-like 5.7e-31
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 
Domain Number 2 Region: 365-466
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.16e-22
Family Canonical RBD 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000057072
Domain Number - Region: 471-492
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00667
Family CCCH zinc finger 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057072   Gene: ENSDARG00000039082   Transcript: ENSDART00000057073
Sequence length 501
Comment pep:known chromosome:Zv9:13:40595043:40630460:-1 gene:ENSDARG00000039082 transcript:ENSDART00000057073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGLMKFSLDLCRLLGLSGSSDERTEEMDTNAIHEQNDDTLSQDVLIGEEGLSEEEKARR
KAERRKAKRKRQRQRKKLERVKKDESTEQEEEEEEEEEEEDDAGPDSELDESEESELEEV
VVSKVEEKPVALLNKSPSGPPLASGNKSNRQQGARSGEEDPGWDVNSAFVANAVSHIRPK
AKSKGKSKENKENESRPAEVIGFSEAKTKRSASLVEKGIRFVQEGQYTQAVSLFTEAIKC
DPKDYRFFGNRSYCYCCLEQYALALADAEKSIQMAPDWPKGYYRRGSALMGLKRYSEAEK
AMEQVLKLDGDCEEAVNDLLYCKVQQLTELGYDEEQSIQLLEKYNTVQAVVAAKASNQDC
ALLQPGPCNSLWVGNVTTELTEKHLRDLFKIYGEIDSIRVLHERFCAFVNFKNANMASRA
MEKLNGHFIENTRLVVRYPDRRIQRVLPTPAMQQPAGATGPRRRGPVNGDECYFWRTTGC
HFGDRCRYKHIPDHRGKDWQP
Download sequence
Identical sequences XP_005169572.1.45394 ENSDARP00000057072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]