SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000057566 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000057566
Domain Number 1 Region: 30-112
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-18
Family Synaptotagmin-like (S variant) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000057566   Gene: ENSDARG00000039393   Transcript: ENSDART00000057567
Sequence length 134
Comment pep:known chromosome:Zv9:4:7222957:7224116:-1 gene:ENSDARG00000039393 transcript:ENSDART00000057567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLYDLRLVSLAVLMLAFHLDFGKADVRVFDIHAMDLSGDVIGNKPDPYIKIWCGSTFG
GMTEFLNSTNNPEWSAEFSFPICKATEILKLEVWDKDLFFDDKLGTCTRTVQYGSFDIPC
HLSKGTLFYKYELR
Download sequence
Identical sequences A4FVG5
7955.ENSDARP00000057566 ENSDARP00000057566 ENSDARP00000057566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]