SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000058220 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000058220
Domain Number 1 Region: 19-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.42e-36
Family WD40-repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000058220   Gene: ENSDARG00000054355   Transcript: ENSDART00000058221
Sequence length 342
Comment pep:known chromosome:Zv9:3:31854267:31863925:1 gene:ENSDARG00000054355 transcript:ENSDART00000058221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLEEESSEFV
CRNTFDHPYPTTKIMWIPDTKGVYPDLLATSGDYLRIWRVNDTETRLECLLNNNKNSDFC
APLTSFDWNEVDPNLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDI
AFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATM
AMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP
RAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Download sequence
Identical sequences Q7T3E0
ENSDARP00000058220 7955.ENSDARP00000058220 NP_956363.1.45394 XP_016112489.1.42290 XP_016302509.1.79318 XP_016323549.1.79318 XP_016395579.1.44103 XP_018931965.1.5815 XP_018980370.1.5815 ENSDARP00000058220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]