SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000058363 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000058363
Domain Number 1 Region: 88-168
Classification Level Classification E-value
Superfamily HMG-box 9.29e-29
Family HMG-box 0.0000185
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily HMG-box 8.38e-25
Family HMG-box 0.0000189
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000058363
Domain Number - Region: 187-213
Classification Level Classification E-value
Superfamily ARM repeat 0.000345
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000058363   Gene: ENSDARG00000053990   Transcript: ENSDART00000058364
Sequence length 214
Comment pep:known chromosome:Zv9:23:45378522:45382172:1 gene:ENSDARG00000053990 transcript:ENSDART00000058364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKGDVNKPKGKTSAYAFFVQTCRDEHKRKSPDVPVNFSEFSKKCSERWKSLNASDKVKF
EDMAKADKVRYDREMKTYVPPKGVGKTGRKKKDPNAPKRPPSAFFVFCSEYRPTVKSEHP
NLTIGEIAKKLGELWSKQSSKDRAPFEQKAGKLREKYEKEVAAYRAGGGASKRGPGRPTG
SVKKSQAEADDDDDEDEDEEDEEDDEEEEDEDDE
Download sequence
Identical sequences Q66IB6
ENSDARP00000058363 ENSDARP00000058363 NP_001004674.1.45394 7955.ENSDARP00000058363 7955.ENSDARP00000070597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]