SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000058909 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000058909
Domain Number 1 Region: 48-125
Classification Level Classification E-value
Superfamily HMG-box 1.7e-28
Family HMG-box 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000058909   Gene: ENSDARG00000040266   Transcript: ENSDART00000058910
Sequence length 293
Comment pep:known chromosome:Zv9:7:27620451:27623815:-1 gene:ENSDARG00000040266 transcript:ENSDART00000058910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYSMMEHELKTAGPPHTLQHSPGMSPPGSGVGNAHHGSKTACPPGVDPMDKVKRPMNAF
MVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLTDVEKRPFIDEAKRLRAVHMKEYPDY
KYKPRRKTKALMKKDNPVGKYPLAAGNLLASAVAQGQGGSPRMDGYGWGHAGGYMGMQGD
ALGYPQQLHRYDLSALQYPAAQPYMNSASSYSQMSYSSSAQQPSPVMSMVKPEPLSHSPT
GVPNHHRGAFQGDLRDMISMYIPGGDTSESSNQRAYPGVQQHYLGGTVPLTHI
Download sequence
Identical sequences F1R211
ENSDARP00000058909 7955.ENSDARP00000058909 ENSDARP00000058909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]