SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000059399 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000059399
Domain Number 1 Region: 112-216
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000445
Family Staphylococcal nuclease 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000059399   Gene: ENSDARG00000040582   Transcript: ENSDART00000059400
Sequence length 249
Comment pep:known chromosome:Zv9:18:32373426:32384184:-1 gene:ENSDARG00000040582 transcript:ENSDART00000059400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVPADNTDDAKPSKNFVALLSNFADDHLTVVRSISTCIGLAGLLIVARSIRLMTKFGS
GTDIPARFIERNIIIRGRLRNITEKGLEVEHIPISVPLLSRLLAKRQTEALLDVRLAGVE
LTSEGHHWIGQQLRPAETVWLRLIARQNETLHCLVSVNKGSLFNTCVNEELLRLGLARTS
PLVVLDPHSQIYWSLYKRLLRAESKAEKKGKGLWKEESRWERFTDVLRNNMLLVSLKKLF
KWRSGTKEK
Download sequence
Identical sequences B8JLW4
NP_001138268.1.45394 ENSDARP00000059399 7955.ENSDARP00000059399 ENSDARP00000059399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]