SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000060243 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000060243
Domain Number 1 Region: 151-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 2 Region: 63-139
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 3 Region: 418-473
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000705
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000572
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000060243
Domain Number - Region: 258-402
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.034
Family Phase 1 flagellin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000060243   Gene: ENSDARG00000017673   Transcript: ENSDART00000060244
Sequence length 473
Comment pep:known chromosome:Zv9:15:28035369:28108277:1 gene:ENSDARG00000017673 transcript:ENSDART00000060244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHHHNQQPHMESDPPDSRKRPLETPTEASSTKRTNTGDRCNQAAIHDPPFSSDIVGFHEE
GEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVE
ALNNVHDFIAEKVREMPQSAQKTEPVSILQPQTTVNPDRVKQAKLIVPNSTAGLIIGKGG
ATVKAVMEQSGAWVQLSQKPDGINLQERVVTISGEPEQNRKAVEIIVQKIQEDPQSSSCL
NISYSNISGPVANSNPTGSPYANSAEVMPAAAAAAAATASSLLGQASLAGVGAFPTTMSS
FSGNDLLAITSALNTLASYGYNTNSLGLGLNPAAASGVLAAVAASANPAAAAAANLLASY
ANDASTSAGHPATSLGGFTLGSLAAATGATNGYLSAASPLVASSLLATEKLAEGAKDVVE
IAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGSP
Download sequence
Identical sequences 7955.ENSDARP00000060243 ENSDARP00000060243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]