SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000060864 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000060864
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-30
Family Synaptotagmin-like (S variant) 0.077
Further Details:      
 
Domain Number 2 Region: 112-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.87e-28
Family Synaptotagmin-like (S variant) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000060864   Gene: ENSDARG00000041515   Transcript: ENSDART00000060865
Sequence length 241
Comment pep:known chromosome:Zv9:8:1834093:1865089:1 gene:ENSDARG00000041515 transcript:ENSDART00000060865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARNTSLYFRIVEGKNLPAKDVSGTSDPYCIVKVDNEVVARTATVWKNLNPFWGEEYTLH
LPMGFHTLTFYVMDEDTIGHDDVIGKISLSKDVIAAQHKGLDNWLNLTRVDPDEEVQGEI
HLALELQREKHRSCLSCHIIEARDLAPRDITGTSDPFTRIIYNNLSAETSIIKKTRFPHW
DETLELCLDEADEDEGGMVTVEVWDWDMVGKNDFLGKQVEIPLSCLLRSPVLQGWFRLMP
L
Download sequence
Identical sequences ENSDARP00000060864 ENSDARP00000060864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]