SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000061662 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000061662
Domain Number 1 Region: 263-403
Classification Level Classification E-value
Superfamily RNI-like 9.22e-19
Family Cyclin A/CDK2-associated p19, Skp2 0.021
Further Details:      
 
Domain Number 2 Region: 219-272
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000183
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000061662   Gene: ENSDARG00000042072   Transcript: ENSDART00000061663
Sequence length 409
Comment pep:known chromosome:Zv9:8:1358416:1367739:1 gene:ENSDARG00000042072 transcript:ENSDART00000061663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHFLSKNGYGLKKKTRKLRKKKRRRNCFLQGPCMLCFIVHGSSGTLEDDWPFESGCAAA
VSKLAERYVTLNSPEECAKFLLSPVWEGQGRNLLSAVPTKLIGPPALFCEYSEMVCKRKC
ADLQRCSPRKQPRCAFPGPMENGEERGDAAAPDSHCLLPSICPLPSSSSSSSSSASEEDG
ATAGRHSDPGGATTCSSSSCCCQTEASEEIKSTENTDTSHINQLPSSILLKVFSHLSVKE
RCLAASLVCKYWRDLCLDFQFWKQIDLSGLQQVKDDLLVKIASRRQNVTEINISDCRNVQ
DHGVCALASNCAGLIKYTAYRCKQLSDVSLSTVAIHCPLLQKVHVGNQDKLTDHALKLLG
DHCKELKDVHFGQCYSISDEGLMSLAQGCNKLQRIYMQENKLVSQAGIY
Download sequence
Identical sequences XP_001335097.5.45394 ENSDARP00000061662 ENSDARP00000061662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]