SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000063569 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000063569
Domain Number 1 Region: 296-478
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.86e-42
Family DNA polymerase beta-like 0.0000245
Further Details:      
 
Domain Number 2 Region: 143-233
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 2.35e-28
Family DNA polymerase beta, N-terminal domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 600-668
Classification Level Classification E-value
Superfamily Homeodomain-like 3.59e-22
Family Homeodomain 0.0016
Further Details:      
 
Domain Number 4 Region: 238-293
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000000000000556
Family DNA polymerase beta-like, second domain 0.0012
Further Details:      
 
Domain Number 5 Region: 27-124
Classification Level Classification E-value
Superfamily BRCT domain 0.00000349
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000063569   Gene: ENSDARG00000042507   Transcript: ENSDART00000063570
Sequence length 745
Comment pep:known chromosome:Zv9:10:46328704:46360468:1 gene:ENSDARG00000042507 transcript:ENSDART00000063570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLKRRKVSVPVKQQTGSCKYPQVCIFILERKMGASRRAFLTRLGRSKGFLIEDSYSSS
VTHVVSENSSAAEVQAWLEKHTRASSSDHLLEKHTHAASSSSVHLLDICWFTESMEAGEP
VPVQHTHTLQINPELNGDGAEILMKSYACQRRTPLKHHNAFLTEALEILAQNAEFNDNEG
RSVAFRRAASVLKALPHRVKSMEDLRCLPCLGDHSQRVIKEILEDGSSREVESTRQSEQF
QAMKALTGVFGVGVRTADRWIREGLRTPDDLIRTGQQLNRAQQAGVQYYSELQRAVTRAE
AELIMAIVEAAVNSVLPGCQIQLMGGFRRGKEVGHDVDFLITHPEEGKEEGLMLKIISWL
EEQGVLLYQKTTRNSYVERLDGPARSASNMDRFERCFSIFKLHSSASRSGSASTSESGSA
CDSGCRAVRVDLVVSPFSQFAFATLGWTGSKLFERELRRWAGQEKQMTLSSHTLYDSKQS
SSSVRDEQQTSSTSTDSLPGSYSRWTSPHMEKHMEEKYTEEKYLQEKSMEKFMHEKYTEE
KHMPEKYTEGKRIQKHTHESGFSSSTEDEELSGCESEGSRSEGSGSRSPAAPGSVAPASG
SGSPSSGRRPRTAFSSEQISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRM
KLKRTVQDSLAQACQVKVASHMMHYSDLHSFRAAPYPSFYPETPAAFAPPYPISPAAESL
YYSSYQNLQGVPSIPVHPYQYYSTH
Download sequence
Identical sequences ENSDARP00000063569 ENSDARP00000063569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]