SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000065024 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000065024
Domain Number 1 Region: 47-116
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000019
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000065024   Gene: ENSDARG00000044290   Transcript: ENSDART00000065025
Sequence length 117
Comment pep:novel chromosome:Zv9:5:62614804:62620397:1 gene:ENSDARG00000044290 transcript:ENSDART00000065025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTMFGSENEQWVCPNDRQLMLRAKLHTGWSIHTFQSERQRKAQALEKRELDLIMSVIH
RAEQLELIEQHRIGRLVERLDNMRSSAMGNGLSQCLLCGEVFGLLGSSSVLCLDCCM
Download sequence
Identical sequences B8K0F3
7955.ENSDARP00000065024 ENSDARP00000065024 ENSDARP00000065024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]