SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066950 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066950
Domain Number 1 Region: 166-268
Classification Level Classification E-value
Superfamily WWE domain 3.01e-20
Family WWE domain 0.003
Further Details:      
 
Domain Number 2 Region: 278-363
Classification Level Classification E-value
Superfamily WWE domain 3.14e-18
Family WWE domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000066950
Domain Number - Region: 50-74
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000157
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 74-97
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066950   Gene: ENSDARG00000045530   Transcript: ENSDART00000066951
Sequence length 363
Comment pep:known chromosome:Zv9:4:25183514:25195186:-1 gene:ENSDARG00000045530 transcript:ENSDART00000066951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMASNYQEDSAEGGDQLSGESGSDFSDTDTDSDASTDSDSDSEDAPQTPNKRNVCKYYN
RGQCRYGEKCRDEHVCSNFLNNSCKYGTGCRLNHNRQSPSSAQDRQKRSRRSPAETEDEE
FEGPYRWQLNTGKGWKNISNDHILEAQYSLPNTKGIKIYNTSAGAVSIDFMKMRVLKKTN
IKVRRMSSKDTEWLWYYRGNHCWYRYGDKGKSSPIQSSKLETEFQKNRNGSVKLTIDSTQ
YEICFKGMRQRNVSTGHKRTIRRRPKYEPPNDGGLHALSSRIKNMMSPSTNKTPEWQFHG
RDHWHTFKNTGGCSVSSADIERCFQKNQTTMNFTVNEDNYTLDFGRMRQINQRTKAERKV
RRV
Download sequence
Identical sequences Q5RGN8
NP_001014347.1.45394 ENSDARP00000066950 7955.ENSDARP00000066950 ENSDARP00000066950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]