SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069204 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000069204
Domain Number - Region: 148-206
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000213
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069204   Gene: ENSDARG00000038445   Transcript: ENSDART00000074718
Sequence length 206
Comment pep:novel chromosome:Zv9:16:56398544:56415944:-1 gene:ENSDARG00000038445 transcript:ENSDART00000074718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSFDSSDVSSSDGARKASSTLSLANASSFQQNSSGFQRKRLQAPTLAEMDSSDSDDET
VGHRSASCSSISTTMVDDTSPESVLGKKTPPMFLPISSTPQPERRQPAQRRHSIEKETPT
SVRQFLPPSRHSSKSLEEFCFPVECLALTVEEVMHIRQVLVKAELEKFQQYKDIYNALKK
GKLCFCCRTKRFSLFTWSYTCQFCKR
Download sequence
Identical sequences ENSDARP00000069204 ENSDARP00000069204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]