SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069214 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000069214
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.89e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069214   Gene: ENSDARG00000027887   Transcript: ENSDART00000074728
Sequence length 243
Comment pep:novel chromosome:Zv9:13:44269007:44288601:1 gene:ENSDARG00000027887 transcript:ENSDART00000074728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVPDGKKLVRSPSGLRMVPENGAFNSPFTLDEPQWVPDKECPRCMQCDTKFDFITRKH
HCRRCGRCFCDKCCSQKVALPRMCFVDPVRQCAECSLISQKEVEFYDKQLKVLTAGGTFV
VKVGSSEKSETMVCRLSNNHRYLFLDGNSHFEVELSRISSMQVLTEGSTPGEKDICSYTS
LLDNQISEGGTLRASGMVLQYKPPGSLDLQQLNMDTADDKRIASAWLAAMHKAAKLLYES
KDQ
Download sequence
Identical sequences B8A6I2
ENSDARP00000069214 XP_005157097.1.45394 ENSDARP00000069214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]