SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000069273 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000069273
Domain Number 1 Region: 70-191
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.33e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000069273   Gene: ENSDARG00000052856   Transcript: ENSDART00000074787
Sequence length 370
Comment pep:known chromosome:Zv9:13:45634912:45641972:-1 gene:ENSDARG00000052856 transcript:ENSDART00000074787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPNSNKRKNNAGDGKYLPELLAEKDSLDSSFTHAMKLLSAEIERVQKGEPKKDSELYLD
LFASKSVRVKERVLIPVKQYPRFNFVGKILGPQGSTIKRLQEDTGAKISVLGKGSMRDKN
KEEELRKGGDPKYAHLGMELHVHIEVFAPIPDCYLRMAHAMDEVKKFLMPVEGMDEMHPD
AFMDPGFLNGAQDMSGHGRGMPGRGRGGPPPMGARGRGMPPRGAPRGGAPRGGPGRGAAA
RGAPAGRGGPQPPTPTRGGAASRSRPPTQAARMTPAAGLSHQQAKPETYGEYAYEEPYAE
ASYEGYESYYSQQPAQPDTEYYDYGHGEAQESYESYTEDDWEGGAWGGAGGKAPTARQGK
SFREHPYGRY
Download sequence
Identical sequences Q6NW56
NP_571000.1.45394 7955.ENSDARP00000069273 ENSDARP00000069273 ENSDARP00000069273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]