SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070020 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070020
Domain Number 1 Region: 25-55
Classification Level Classification E-value
Superfamily F-box domain 0.000000157
Family F-box domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000070020
Domain Number - Region: 291-355
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0863
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070020   Gene: ENSDARG00000053505   Transcript: ENSDART00000075538
Sequence length 385
Comment pep:known chromosome:Zv9:7:31299086:31304859:1 gene:ENSDARG00000053505 transcript:ENSDART00000075538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDAVPPSILGESKAGYVLGNVAEVVERILTFVPTKNLFRVASVCRLWRNCARRVLRTQ
QRLTWLSASGSSICREHVLFTTMEEDLENVYLLPQTALLMVDGDFIWPYTYLTDTRSCDE
VVPDPVEKLRRILPKNCDILGIVAAGIVVTPSGSPSSPPQEHEAGEAGFSLLFPAMDGVT
IQSFHFCKKSFSDTAMEEAGLINNPDLKVVLMFNYNTYKPGGGRFLNKLLEPLSQSNILV
VGGQVEREFTNEPTCCSEDSYGAVGLSISGSKVQGASVLVEQDVSTAKGAEATIQRLKAA
NIPERNTMGFMFACVGRGHNSYNDQLNVEADAFRKIFSNIPLLGFFGNGEIGCDRIVKEN
YTLSETDADGLQHSFTTVMSLVHFG
Download sequence
Identical sequences Q5SPK4
ENSDARP00000070020 NP_001025277.1.45394 ENSDARP00000070020 7955.ENSDARP00000070020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]