SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070070 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070070
Domain Number 1 Region: 248-505
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-30
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070070   Gene: ENSDARG00000053554   Transcript: ENSDART00000075588
Sequence length 535
Comment pep:known chromosome:Zv9:7:31538204:31546297:1 gene:ENSDARG00000053554 transcript:ENSDART00000075588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDKSDLSLETMQLLQERTPPQNPGMDGSVLRTSRRIKEKQNQRKKQILPPKCLTFRSE
VKSTRRAVKRRISGSEKEKEVKRSKADPDHESLPGYREGLSEYQLERLENIRKNQAFLNS
LNLTEISEALRPKQKPTQKGLKKEKTQVEMLPVRKSLRLQNKGPQSTTATEFTFPTTYEL
EKEAKPPGPIPLDPINLDEDATLPDDLLDVWNEVPLEQSTGTPDLKSYERMLKKLSIDDS
RVVKVVKERICCAAFHPSSNLLMAAGDKYGHLGLWRPDAEWGDDGVVCFEPHSRAITALA
FTSQPCNLITASYDGSARSMDLEKAVFDEVYRSSSSLKSFDFLSSDCSTLLFGEWNGDVA
IVDRRTGNSCESLHAMTAAPLRGVHVHPVQQHYFLVAESSFVNIYDLRHLKKRNSPAVCE
LYGHSRSTSSAFFSPLTGSRVLTTCMDDCIRVFDSSQIAGSIPALTSIRHNMQTGRWLSR
LCAVWDPKHQECFVIGTMDRPRKIKHSTLAGTLCLEAMQVGGCTSTLTDLSTRKD
Download sequence
Identical sequences ENSDARP00000070070 ENSDARP00000070070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]