SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070393 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070393
Domain Number 1 Region: 193-517
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.5e-50
Family WD40-repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070393   Gene: ENSDARG00000000324   Transcript: ENSDART00000075913
Sequence length 607
Comment pep:known chromosome:Zv9:2:37705475:37725422:1 gene:ENSDARG00000000324 transcript:ENSDART00000075913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTGGKSSIPNGGSDDPEPGEGRGEAETSDASAVAEAQASPESANLNSAAEGSAVGQDK
LMADSEQKQGPAEEEDTDSMDGSGLYSLTEEGERESEGGGRGKDEGKRSARKRNRPSGGA
AHHSSSSDDDDENEEDDDVEEEDEQAMEAWLGADLCDLSRPSWRAIPSLRAREIGRDSQQ
FVRKVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDDLRVVIWDWARRKAE
LEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKRVAQHKGAAHK
LALEPDSPCSFLSAGEDAVVFGIDLRLDRPANKLVVVKEGEKKVGLYTIYVNPANTHHFA
VGGRDQYVRIYDQRKINEHDNNGVLKKFCPSHLVSSESKTNITCLVYSHDGTELLASYND
EDIYLFDSSHSDGADYHRKYKGHRNNATVKGVNFYGPCSEFVVSGSDCGHIYLWDKNSAR
VVQFMEGDRGGVVNCLEPHPHLPGLATSGLDHDVKLWAPTAENPTTLKGLKEVMKKNKRE
RDEDNVRHGDQYDTQLLWFLMRHMRNRRPQRTRRGEGGEGDTDESWSSPESSDEEDGGPD
HVQCMSS
Download sequence
Identical sequences F1QNH5
ENSDARP00000070393 XP_021323428.1.45394 XP_021326944.1.45394 ENSDARP00000070393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]