SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070545 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000070545
Domain Number - Region: 200-236
Classification Level Classification E-value
Superfamily HMG-box 0.00759
Family HMG-box 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070545   Gene: ENSDARG00000053950   Transcript: ENSDART00000076066
Sequence length 236
Comment pep:known chromosome:Zv9:15:36288169:36298089:1 gene:ENSDARG00000053950 transcript:ENSDART00000076066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHCKIKTEKTDAGARNRLDAVLQGLVERSDSEREQNEEDSGKMVADSLAKDLSPSSAGK
RPSSRFPQHRRKKRKEMDDSLSETNQHKQNAYIIKLFDRSVDLAQFSTTTPLYPICRAWM
RNNPAMRERTAPSPPHSSGEEEMTDMLNGKGQNVYKLPPPVSCPVSSSGEAVNLRIPPVE
KTAQNQSIDTAAGTSTLMFNHIKRWKKIRQKWKEASSKNQLRYSESIKVLKEMYER
Download sequence
Identical sequences F1QNC3
ENSDARP00000070545 7955.ENSDARP00000070545 ENSDARP00000070545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]