SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070753 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070753
Domain Number 1 Region: 73-362
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000663
Family Internalin LRR domain 0.017
Further Details:      
 
Domain Number 2 Region: 15-59
Classification Level Classification E-value
Superfamily F-box domain 0.0000000628
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070753   Gene: ENSDARG00000054128   Transcript: ENSDART00000076276
Sequence length 364
Comment pep:known chromosome:Zv9:17:28667196:28669901:-1 gene:ENSDARG00000054128 transcript:ENSDART00000076276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCRRLLRRKTMSYIQLPEEIWIHVFGFLSVRDKLSVRVSCTYFKGLVDHWALWKDSVLLI
QKPGVYDTHFWKTLSRRKVKSVVVEKAKAKVLQQIVLYLPWVTSVNLLECSDDTALVTLA
ALKHLDRLVICQCSCRSLISSLLSLRNLTHLCLCGVQRASIVEIRNVLSQLTNLTSLHYH
DDKNPINKTALHSLLTRLNNLKHLSLKMGPKSMWTFSFFYLSPIICLTAGEESVLNSLEL
LNYEDSCLSPDAFSALSSLTKLSVHYTKCIFCPLACPLIKWLEELCVLSELNISYGYSLE
MYAGSIPRIVRRLSLMGVKADLASVRILAKRLPELLHLHLDLCCHDISHIIAEMPQMFPK
LQIL
Download sequence
Identical sequences ENSDARP00000070753 7955.ENSDARP00000070753 ENSDARP00000070753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]