SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072168 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072168
Domain Number 1 Region: 141-241
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-18
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily SAND domain-like 1.34e-17
Family SAND domain 0.0024
Further Details:      
 
Domain Number 3 Region: 67-125
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000442
Family PHD domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072168   Gene: ENSDARG00000055359   Transcript: ENSDART00000077702
Sequence length 245
Comment pep:novel chromosome:Zv9:3:24837780:24845598:1 gene:ENSDARG00000055359 transcript:ENSDART00000077702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLYKGRFATGRRGKCIRTEERWFTPEEFVKEEPTLTDGLWKRDILCHGKTLNFLCKRVLS
GHMNTIINKMEQNNDDVCYACHCGVDLRCCDGCPRAFHSDCHLPAVPEGSGEWICTFCVL
KTSLQWRASSNMTEQEAFDSPVSQYILQCHYLLLCMYKEDIQRVFVEDPRPNKSTSRGTL
SPMWLDRIKSKLESKKYQKFGEFVSDFRLIFSNCKNFNKDNEFGQLGAKLKEIFEEEIQK
IFFIQ
Download sequence
Identical sequences ENSDARP00000072168 ENSDARP00000072168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]