SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072799 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072799
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily TPR-like 2.17e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 807-839
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000314
Family CCCH zinc finger 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000072799
Domain Number - Region: 496-525
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00167
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 623-656
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0161
Family CCCH zinc finger 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072799   Gene: ENSDARG00000055930   Transcript: ENSDART00000078337
Sequence length 904
Comment pep:known chromosome:Zv9:12:20252401:20280910:-1 gene:ENSDARG00000055930 transcript:ENSDART00000078337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLERQKRKEEIQKALGFIQSSLPFPEPEGYEAFLTQLVCNLLDEGNAVYRDGEWRQAAV
HYSEGVNVARYAQSEALVIPPELLESLYVNRAAAHYSLGEYERGVQDCDSALCVSEGSRR
ALYRKALCLRDQGRFREAYECGTGCLLTAPHDRQVSELAQDLANKLGLKIRKAYVSPQLD
STTSGTDNNGETNSPTGETSSNGLETLNDIGSDLTSAQCIPAPLATPIPVSDDPQIPSLD
PVEPQDMPESPSQEPSGRVPYSVPVSEHMGECVMNEDTSCLDTLLESIPKGAEVSVNPVQ
GAIPTNLPNTAVGLRPPYSPGLPGSTPQLAAQFFNSAVSPLPPLEPFTALGQSEASSQTM
ESLGSFSSGAADTAGKGSLITGGLDSLSEYTLPGGRISHCFIPGLRNHNAANANGPVGTN
LSLLSRNPLAATHEFRQACNACYSRIGPRVMDYHYQPEAAHRCKRDVLLCRLKTADDPIW
KRVRPRPARNNFLGAFVLCKEVQERQECQYGENCTFAYCQEEIDVWTQERKGALSRELLF
DPLGTNERRALSVTRLLQLHMGMFMFLCEECFDSKPRIISKRSKENLAVCSNLTARHPFD
DNKCLVHVVRSANVRYSKIRPLHPLCQFDVCRHEVRYGCQREDSCSFAHSVIELKCWVLQ
QDTGITHEEMVQESKRHWHRLEQNAQRQKPMPGPHQPSGSSSGGISGSSVVSGGVVGGGG
DSISGGGGGGGGLVGCGRGRGLNLKMKFVCGQCWREGQVNEPDKSLKYCTAKARHSWTKE
RRVLLVKSFEKKKWVVVRPLPFSRTYPQQYDMCVHVMKQKKCHYIGNCSFAHSLEERDVW
TYMKNNSLRDMQQMYEMWLSLTNQHRRADSNLMTPPPEEKQIAMPTDCSESMVGRRMSGG
GGDL
Download sequence
Identical sequences E7F4T4
XP_021335972.1.45394 ENSDARP00000072799 ENSDARP00000072799 ENSDARP00000127373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]