SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000073718 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000073718
Domain Number 1 Region: 82-161
Classification Level Classification E-value
Superfamily HMG-box 5.11e-28
Family HMG-box 0.0000393
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily HMG-box 1.57e-24
Family HMG-box 0.0000302
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000073718
Domain Number - Region: 186-212
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000073718   Gene: ENSDARG00000056725   Transcript: ENSDART00000079262
Sequence length 213
Comment pep:known chromosome:Zv9:7:27041018:27044148:1 gene:ENSDARG00000056725 transcript:ENSDART00000079262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGDPRKPKGKMSAYAYFVQTCREEHKKKSPEIPVSFSEFSKRCSGRWKAMTDKEKSRF
EDMAKQDKVRYDQEMMHYMPGKRGKKKDPNAPKRPPSGFFLFCSEHRPQIKAQYPSLGIG
DVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVADYKTKSKAGGVSMGMGMPMANCM
PPKPMMKSNMDDEEDDEEDEEEEEDDDEYDDDE
Download sequence
Identical sequences F1QGP8
ENSDARP00000073718 NP_001116308.1.45394 7955.ENSDARP00000073718 ENSDARP00000073718 ENSDARP00000111817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]