SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074209 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074209
Domain Number 1 Region: 122-431
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.14e-57
Family Extended AAA-ATPase domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily MIT domain 4.58e-28
Family MIT domain 0.00000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074209   Gene: ENSDARG00000069175   Transcript: ENSDART00000079757
Sequence length 437
Comment pep:known chromosome:Zv9:2:13047975:13060553:-1 gene:ENSDARG00000069175 transcript:ENSDART00000079757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANNNLQKAIDLANKASQEDKAENYEEALRLYQHAVQYFLHVVKYEAQGDKAKQSIRAK
CAEYLDRAEKLKEYLKKKEKAPAKPVKESQSNDKGNESDGEEDPEKKKFQNQLSGAIVME
KPNIKWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSISSSDLVSKWLGESEKLVKSLFTLAREHKPSIIFIDEIDSLCGSRSENE
SEAARRIKTEFLVQMQGVGNDNEGILVLGATNIPWTLDSAIRRRFEKRIYIPLPEEHARS
FMFKLNLGTTPNSLTESDFMTLGKKTDGYSGADISIIVRDALMQPVRKVQSATHFKQVRG
PSRSDPNVIVDDLLTPCSPGDPQAKEMTWMEVPGEKLLEPIVSMSDMLRSLSNTKPTVNE
QDLEKLKKFTEDFGQEG
Download sequence
Identical sequences A5WWM0
NP_001094432.1.45394 NP_001278351.1.45394 ENSDARP00000074209 ENSDARP00000074209 ENSDARP00000111799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]