SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074624 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074624
Domain Number 1 Region: 85-166
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000699
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074624   Gene: ENSDARG00000057491   Transcript: ENSDART00000080174
Sequence length 849
Comment pep:known chromosome:Zv9:18:18065201:18081710:1 gene:ENSDARG00000057491 transcript:ENSDART00000080174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRITEVTCTEPPGGRQSPTASRAQPDSLTVDEFTVHEDKQTELKCSKPKVEQVFQVTFT
IIGLLDHTGAHGSKASRQIWLQLKGKKEDVYKAKEYVKGLCDPELQKEEWYPVDMHCIFA
GARGLFLDRLLRDTSAEVQVLEPGRLKLSGCAEAVVMAQSRVQQFVALFQEKRSLPADRE
PSVKRKFKTFVEDRADKYAMELLLLPSALKEELLGLAQSPTQPIVIIDLEQDRSQTSTPV
TDLSNRILDTTFEDKTSPITPEVMPGLNGRPCNKRRSSESEQRDTKRQYSLERREEEQCE
EREREPTKTWTVKSAKGTLAASEMTNESEAVSPETNLRCLVNFFRTMGYQQDVVERVVRE
TGQTEDTFLLLERIVEETQKTQSTQGAQRTSRTPDPSPCANASSTSTSNRLKEKERVQMR
ALAEIKCKENIRPPSTNGIGQKNQTSSVPLASATLKRNNGAQTDLCEVIIIDDEEDFTET
ERKPRLTPLDLKPESRFDYLPRGSSQTMVPVRMETVTNLRSSSQGPPLRTSDTRPGCSYQ
TLPGRAPLPRSEAQYTSKAAPLTGMSRFQQSLRTPYRLILQNEPGSPNLRHIIIDGSNVA
MAHGLHRVFSCRGIAIAVEAFWRRGHREITVFVPQWRQKKDPNITEQHFLNQLENLRLLS
FTPSREVCGHRISSHDDRFLLHLAEKTGGVIVTNDNLRDFVSQSEAWRRIIHERLLQFTF
VEDHFMIPDDPLGKHGPHLDEFLLKDSRGSPIIPPLRTDLRATPSVYSQAAQSTAHPSSP
SHWPHSGPPDWHLPRPSPSPPPQRSPSETTELKRKLYDIFPDQKQRIDRILSDNPYMRDL
NALSGLLLG
Download sequence
Identical sequences ENSDARP00000074624 ENSDARP00000074624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]