SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074801 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074801
Domain Number 1 Region: 577-774,863-1189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.79e-74
Family Tandem AAA-ATPase domain 0.025
Further Details:      
 
Domain Number 2 Region: 322-349
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000209
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000074801
Domain Number - Region: 362-435
Classification Level Classification E-value
Superfamily UBC-like 0.0371
Family UBC-related 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074801   Gene: ENSDARG00000057660   Transcript: ENSDART00000080351
Sequence length 1430
Comment pep:known chromosome:Zv9:13:7683913:7716533:-1 gene:ENSDARG00000057660 transcript:ENSDART00000080351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRRRSKPNRGGGRFNKPRGGRGGGGGGGGGGGGKKFASGGWDDGDDFSLDFGPSRSFK
PPSSRGSRGGGVRGAQGGRGRGRSLGLPRKHDDDEEKRSRFRSEQVPLPLQKIHMTSENK
LQVKELLRELQNQEYQTPNSGSDYEGGEEEEDEEYDELDHREEGQYWITHDDGVEYAETD
DWMEDPVEEKHKKPEPVISLFALGTLCRYGFDRERSRQTLEAGEGSGCGEVGATLELLLS
QMFTERFGSSALSPQTSDPPSQGECVALRQEEAFALTAIYGERFCERISNRVWTIQLDLL
WLDERRIKLSDSKHSKKQSESNQICKFYLRGAGCKFGNRCKFKHQVHESSTSRDLCKASQ
PGFSNADAPIYQLEIRFQPGSLYPFQPPLVAFSSTDESLSGAGRLSVTEYLFGQSLSAAE
EGEPVVYTLISSLEEDGPVRELLSAAHHKYSAPPPVLAPPTVTPAKSRSNKNNVDNRTSA
TRDQSTSTSISEITNHRVKQKEVAQILSEDIDDVQDEGDDEDEEECIPVENESYVNLRKR
MVKKTEIRTEQMQEENKKLCREFKRKRSSRRYISMQEQRQKLPAWQKREAILECLVKNQV
LVISGMTGCGKTTQIPQFILDNFLQTGRPDRVANIICTQPRRISAIAVATRVAQERAEAL
GHSTGYQIRLETVRSSITRLMFCTTGVLLRRLEGDPELSGVTHVIVDEVHERTEESDFLL
LVLKDLIVKRTDLKVIMMSATLNAELFSQYFNNCPCIHIPGRTFPVEQFFLEDAIAKTRY
VIEDGSPYRRSTKLNRSSGPGGTTGKGRALVEDFDDDYGGWSFTSFRNKESVKDSVPDQQ
LSQQDLTVRYSNYSKSVVKTLAAMDLDKINMDLVESLLEWIVDGDHSYPPGAVLVFLPGL
AEIKQLYEQLQSNRMFNNRRTNRCVVYPLHSSLSNEEQQAVFTRPQNGVTKIIISTNIAE
TSVTIDDVVYVIDSGRMKEKRYDASRSMESLEDVWVSRANALQRKGRAGRVASGVCFHLF
TSHRFEHHLSQQQLPEIQRVPLEQLCLRVKVLEVFAERPLDSVFSQLIEPPTEGSLEAAK
QRLCALGALTDEESLTPLGWHLACLPVDVRIGKLMLLGAIFRCLDPALTIAASLAFKSPF
VSPWDKREEANEKKLAFSLANSDHLALMQAYKGWCNAAQSGFKAGYQYCRENFLSIRGLQ
EIACLKRQFAELLSDIGFVKDGLKARVIEKMSSKGSDGVLEATGYEANLNSDNTKLMSAM
LCAALYPNVVQVRSPQMKYKLTSKGAMKMQPKAEEQRFMTKSDGAVHIHPSSVNFSVRHY
DSPYLVYHEKVKTSRVFIRDCSMVCVYPMVLFGGGQVNVELQRGQFIISLDDGWIKFAAA
SHEVAELVKELRWELDQLLEEKIKNPSMDLISCPRGSRIIHTIVSLISTQ
Download sequence
Identical sequences F1QCB1
ENSDARP00000074801 ENSDARP00000074801 XP_021336395.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]