SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000074833 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000074833
Domain Number 1 Region: 370-573,665-704,842-930
Classification Level Classification E-value
Superfamily TPR-like 2.85e-65
Family Tetratricopeptide repeat (TPR) 0.00019
Further Details:      
 
Domain Number 2 Region: 36-325
Classification Level Classification E-value
Superfamily TPR-like 4.84e-60
Family Tetratricopeptide repeat (TPR) 0.0000944
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000074833
Domain Number - Region: 334-360
Classification Level Classification E-value
Superfamily MIT domain 0.0942
Family MIT domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000074833   Gene: ENSDARG00000057702   Transcript: ENSDART00000080383
Sequence length 1062
Comment pep:novel chromosome:Zv9:14:18625339:18645644:-1 gene:ENSDARG00000057702 transcript:ENSDART00000080383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVGNVADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINALHK
PAYEHPKDLKASSGRLRVGYISSDFGNHPTSHLMQSIPGMHNSEKFEVFCYALSPDDGTN
FRVKVMAEAHHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGAPFMDYIVSDKATSPIEVAEQYSEKLAYMPNTFFIGDHANMFPHLKKKAV
IDFKSNGHIFDNRIVLNGIDLKAFLESLPDVKVVKMECDGQEVADSNGALSMPIIPMNTA
AEAIINMINQGQIQVTINGFTVSNGLATTQIFTVEEVVVSGTVALQINNKAATGEEVPRT
IVVTTRSQYGLPEDSIVYCNFNQLYKIDPPTLQMWANILKRVPNSVIWLLRFPAVGEPNI
QQYAQNLGLPASRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTM
PGETLASRVAASQLTCLGCPELIAQSRQEYEDVAVKLGTDMEFLKKVRARVWKQRICSPL
FNTKQYTMDLEKLYLQMWENHASGGKPDHLVKMQSLETSEST
Download sequence
Identical sequences A0A0R4ISG3
ENSDARP00000074833 ENSDARP00000074833 7955.ENSDARP00000054555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]