SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000075071 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000075071
Domain Number 1 Region: 131-310
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.72e-69
Family F-box associated region, FBA 0.0000445
Further Details:      
 
Domain Number 2 Region: 72-150
Classification Level Classification E-value
Superfamily F-box domain 9.81e-18
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000075071   Gene: ENSDARG00000071029   Transcript: ENSDART00000080625
Sequence length 323
Comment pep:putative chromosome:Zv9:23:17099224:17108248:1 gene:ENSDARG00000071029 transcript:ENSDART00000080625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSFSGSPLKARTGGSSESNECLSGMGSFGAASRVSVTRPNAAKEKEMIEEQAGQGQSD
VQCQDSGVQLEIPLDVVEEILLNLPAHQVVRVCRLVCPEWKELVDSAAHWRERCRREGIQ
PCDASRPPVDWCQFYILNKNRRNLIKNPKAEAGLQGWEIAGNGDACWLTEENRKPFPENT
VTRCFVSFNGLCLKRQLIDLQKEGYSAAFMDQLQPDIKISDWYTTNTHYKNLYQVNMQLL
DEEMQAITSYHPYKMFLEGDNYPWCEITHVFRNYGPGVRFIRFTHGGLGKQTPRGHNGIR
LTNSSVEICPAAERRTSRMEDGT
Download sequence
Identical sequences A0A0R4ID11
ENSDARP00000075071 ENSDARP00000075071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]