SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000075883 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000075883
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000394
Further Details:      
 
Domain Number 2 Region: 169-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000166
Further Details:      
 
Domain Number 3 Region: 262-341
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000227
Further Details:      
 
Domain Number 4 Region: 375-460
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.04e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000075883   Gene: ENSDARG00000029248   Transcript: ENSDART00000081442
Sequence length 642
Comment pep:known chromosome:Zv9:2:8433634:8447445:1 gene:ENSDARG00000029248 transcript:ENSDART00000081442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSNVAPPSSNAGGGMNDAFKDALQRARQIAAKIGGDGVPPSPVSNDFGYGGQKRPLE
DGDQPETKKVPPSDPFSAVMGGMGGPPRSVSEEFKVPDGMVGFIIGRGGEQISRLQQESG
CKIQIAPDSGGMPDRSVTLTGSPDAIMTAKRLLSEIVEKGRPSPAFHHNDGPGMSVHEMM
IPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRISGDPFKVQQAKDMV
MDLIRDQGFREQRGEYGSRAGGGGGGGESLDVPVPRFAVGIVIGRSGEMIKKIQNDTGVR
IQFKPDDGSTPERIAQIMGPPDRAQHAADIITDLLRSVQAGGPPGHGGGGGGGGGGRGRG
RGQGNWNMGPPGGLQEFTFTVPTMKTGLIIGKGGETIKNISQQSGARIELQRNPPPNSDP
NIKIFTVRGSPQQIDYARQLVEEKIGGPVSPMGGPHGPPGPHGGPSHGPPGPQGPPAPMG
PYNPGPYGQGPPGPHGPPAPYQPQGWGNGYPHWQQGQPDPTVCSPDKAAADANAAAWAAY
YSQYQQQPQGPMTPTSAAPGTTQANGQGQGQPQQDYTKAWEEYYKKQGQAAPQAAAAATA
TQPGGQPDYSAAWAEYYRQQAAYYGQGAPQAMGGAPQAQQGQ
Download sequence
Identical sequences Q6P2A9
ENSDARP00000075883 ENSDARP00000075883 ENSDARP00000105232 7955.ENSDARP00000075883 NP_998309.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]