SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000075888 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000075888
Domain Number 1 Region: 601-644
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000968
Family F-box domain 0.0083
Further Details:      
 
Domain Number 2 Region: 31-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000549
Family SIAH, seven in absentia homolog 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000075888   Gene: ENSDARG00000058561   Transcript: ENSDART00000081447
Sequence length 740
Comment pep:known chromosome:Zv9:17:7460268:7468506:1 gene:ENSDARG00000058561 transcript:ENSDART00000081447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHIHCLKCVNRRCMIRPEASVSCDLMGCPLVCGAVFHSCKLNEHRLLCPYERVPCLN
RGFGCPFTLARVKMAQHLETCPASVVCCTMEWNRWPVSYADRKSYENLSKEVCDVEQLDM
ALALQDQRMLLESLKVATTVTKALEEQNLDNSSPQESDRENDLVIDDLNEVVEGTYNEPF
QDSVEDRSFNANLDILNSPSDIDLIVDHISGEEQNEACSSVRDVNGDLRNDTTKESDTDS
DSDLGAVGGADCAFPVDLEEGDDWLETSGCSESSEEEGELTDGIELNGLHNEVIGDNHQV
RLESVNRSSNISQALPDHSIPVPEVAQLPQRSLPLPIPLPNLMHNNLLHPLPFRYEDRWL
ERKLENLQLLRSMGLFTINGRRTLFSDPYFFKSKMEDKAVDTSDLDVADDPMGLHGIDLI
TAALLFCLGDSPGGRGISDSRFVDGYRIDFGTQTFSLPSAILATSTMVGDIASASACDHA
SPQLSNPSPFHTLRLDLVLECVARYQTKQRSMFTFVCGQLFRRDEFSSHFKNVHGDIHAG
LNGWMEQRCPLAYYGCTYSQRRFCPSVQGFRIIHDRHLGSFGVQPGLAEGEPLSKINICQ
SKSHCDHLSDLPFELLQHIASFLDGFSLCQLSRVSRTMRDVCASLLQSRGMVVLIWEKIK
QADGNSSWQIQDKVWRFSTAFDTVNEWKFANISSMADHLKTCKFNTIARREEAIPLPCMS
FTRELTKEGRSLRSVLKPVI
Download sequence
Identical sequences F1QQR6
ENSDARP00000075888 ENSDARP00000110897 7955.ENSDARP00000075888 ENSDARP00000075888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]